PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009770753.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 200aa    MW: 22402.2 Da    PI: 6.2928
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009770753.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.53.1e-222875249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +i n    qvtfskRr+g++KKA+ELS LC+aevavi+ s+ gk+y +
  XP_009770753.1 28 KIANRNSLQVTFSKRRAGVFKKASELSALCGAEVAVIVESPAGKVYSF 75
                    68899999**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-301978IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.6561979IPR002100Transcription factor, MADS-box
CDDcd002653.06E-322090No hitNo description
SuperFamilySSF554552.09E-252088IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-192141IPR002100Transcription factor, MADS-box
PfamPF003195.0E-242875IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-194156IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-195677IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MEKKNENEDW EKEIKKRSKG RQKIRIEKIA NRNSLQVTFS KRRAGVFKKA SELSALCGAE  60
VAVIVESPAG KVYSFGNPCV DSVINRYETG GRDEDGFSAA LRLQIEEESK KKYLEAMGIL  120
DKEKAVSVGD SGTNNWWEDL SLDNLGLQEL QECMASMEVL KNNLLKRADD LANSSHDVLH  180
QFGALPLHYY NYNLGGPSSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770753.11e-147PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK22e-32AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLM1DJG12e-52M1DJG1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000900245e-52(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-33AGAMOUS-like 62